Product Description

CD2 is a surface antigen of the human T-lymphocyte lineage that is expressed on all peripheral blood T cells. It is one of the earliest T-cell markers, being present on more than 95% of thymocytes; it is also found on some natural killer cells but not on B lymphocytes.
 
Monoclonal antibodies directed against CD2 inhibit the formation of rosettes with sheep erythrocytes, indicating that CD2 is the erythrocyte receptor or is closely associated with it. Recombinant CD2 protein could be serviced as coating matrix protein for study human T cells expansion in vitro.

Full-length extracellular domain of human CD2 gene (25 – 209 aa) was constructed with 31 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Parameter, Testing, and Method CD2 #5086
Quantity 0.1 mg
Volume 0.2 mL
Concentration 0.5 mg/mL
Purity - SDS PAGE Electrophoresis > 90%
Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol
Form Solution
Production Type Recombinant - E. Coli
Storage Temperature -20°C
Shelf Life Minimum of 6 months from date of receipt
Sterilization Method Filtration
Cell Assay Pass
Sterility - USP modified No Growth
Accession Number NP_001758
Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFEL
KEITNALETWGALGQDINLDIPSFQMSDDID
DIKWEKTSDKKKIAQFRKEKETFKEKDTYKL
FKNGTLKIKHLKTDDQDIYKVSIYDTKGKNV
LEKIFDLKIQERVSKPKISWCINTTLTCEVM
NGTDPELNLYQDGKHLKLSQRVITHKWTTSL
SAKFKCTAGNKVSKESSVEPVSCPEKGLD

Directions for Use

Download the full PDF version or continue reading below:

Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.

  1. Thaw CD2 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.  Note: Coating this recombinant protein at 1-10 µg / well (6 well plate) in T cell specific medium can be used for human T cell differentiation study in vitro.
  2. Add appropriate amount of diluted material to culture surface.
  3. Incubate at room temperature for approximately 1 – 2 hours.
  4. Aspirate remaining material.
  5. Rinse plates carefully with dH2O– avoid scratching bottom surface of plates.
  6. Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.

Product Certificate of Analysis

No result for .

Safety and Documentation

Safety Data Sheet

Certificate of Origin

Product Disclaimer

This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.