Product Description

The protein encoded by human CD276 gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Our product (Recombinany Human CD276 ) is derived from Isoform-I (4IgH7-H3). Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3′ UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29.

Full-length extracellular domain of human CD276 gene (29 – 466 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies.  

The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Parameter, Testing, and Method CD276 #5123
Quantity 0.1 mg
Volume 0.1 mL
Concentration 1 mg/mL
Purity - SDS PAGE Electrophoresis > 90%
Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol
Form Solution
Production Type Recombinant - E. Coli
Storage Temperature -20°C
Shelf Life Minimum of 6 months from date of receipt
Sterilization Method Filtration
Cell Assay Pass
Sterility - USP modified No Growth
Accession Number NP_001019907
Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQGEVQVPEDPVVALVGTDATLCCSFSPEP
GFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQR
VRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCS
SYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYS
CLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEP
GFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQR
VRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCS
SYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYS
CLVRNPVLQQDAHGSVTITGQPMTFPPEA

Directions for Use

Download the full PDF version or continue reading below: 

Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.

  1. Thaw CD276 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.  Note: Use 1 ml PBS per well in a 6-well plate.
  2. Add 1 – 10 µg protein to each well and incubate at 2 to 10°C overnight.
  3. After incubation, aspirate remaining material.
  4. Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.

Coating this recombinant protein at 1-10 ug / well (6 well plate) in T cell specific medium can be used 1) for human T cell / receptor interaction study in vitro or 2) as a highly purified recombinant antigen as cancer biomarker for diagnosis application development.

Product Certificate of Analysis

No result for .

Safety and Documentation

Safety Data Sheet

Certificate of Origin

Product Disclaimer

This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.