-
Collagen
-
Type I - Atelocollagen
- PureCol® Solution, 3 mg/ml (bovine) #5005
- Nutragen® Solution, 6 mg/ml (bovine) #5010
- FibriCol® Solution, 10 mg/ml (bovine) #5133
- PureCol® EZ Gel, Solution, 5 mg/ml (bovine) #5074
- PureCol® Lyophilized, 15 mg (bovine) #5006
- VitroCol® Solution, 3 mg/ml (human) #5007
- VitroCol® Lyophilized, 15 mg (human) #5008
- Type I - Telocollagen
- Type I - Insoluble Collagen
- Type I - Bioinks
- Type II Collagen
- Type III Collagen
- Type IV Collagen
- Collagen Standard
- PureCol® Collagen Coated Plates
- Collagen Scaffolds
- Collagen Hybridizing Peptides
-
Type I - Atelocollagen
- Tunable Stiffness
- CytoSoft® Rigidity Plates
- Bioprinting
-
3D Hydrogels
- Thermoreversible Hydrogel
- Silk Fibroin
-
Type I Collagen for 3D Hydrogels
- PureCol® Solution, 3 mg/ml (bovine) #5005
- Nutragen® Solution, 6 mg/ml (bovine) #5010
- FibriCol® Solution, 10 mg/ml (bovine) #5133
- PureCol® EZ Gel, Solution, 5 mg/ml (bovine) #5074
- VitroCol® Solution, 3 mg/ml (human) #5007
- TeloCol®-3 Solution, 3 mg/ml (bovine) #5026
- TeloCol®-6 Solution, 6 mg/ml (bovine) #5225
- TeloCol®-10 Solution, 10 mg/ml (bovine) #5226
- RatCol® for 3D gels, Solution, 4 mg/ml (rat) #5153
- HyStem® Thiolated Hyaluronic Acid
- Methacrylated Collagen
- Methacrylated Gelatin
- Methacrylated Hyaluronic Acid
- Diacrylates
- Collagen Sponges
- Extracellular Matrices
- HyStem / Hyaluronic Acid
-
Adhesion Peptides / Proteins
-
Recombinant Adhesion Proteins
- CD2, 0.5 mg/ml #5086
- CDH3, 0.5 mg/ml #5124
- CDH13, 0.5 mg/ml #5125
- CD14, 0.5 mg/ml #5089
- CDH18, 0.5 mg/ml #5090
- CD40, 0.5 mg/ml #5093
- CD86, 0.5 mg/ml #5096
- CD164, 0.5 mg/ml #5100
- CD270, 0.5 mg/ml #5127
- CD274, 0.5 mg/ml #5126
- CD276, 0.5 mg/ml #5123
- E-Cadherin (CD324), 0.5 mg/ml #5085
- ICAM2, 0.5 mg/ml #5107
- Adhesion Peptides
- Collagen Hybridizing Peptides
-
Recombinant Adhesion Proteins
- Reagents
- Assays
CDH18
Solution, 0.5 mg/ml (Recombinant)
Catalog #5090
CDH18
Solution, 0.5 mg/ml (Recombinant)
Catalog #5090
CDH18 is expressed specifically in the central nervous system and is putatively involved in synaptic adhesion, axon outgrowth and guidance.
Product Description
Full-length extracellular domain of human CDH18 gene (54-608 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies.
The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
Parameter, Testing, and Method | CDH18 #5090 |
Quantity | 0.1 mg |
Volume | 0.2 mL |
Concentration | 0.5 mg/mL |
Purity - SDS PAGE Electrophoresis | > 90% |
Formulation | Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol |
Form | Solution |
Production Type | Recombinant - E. Coli |
Storage Temperature | -20°C |
Shelf Life | Minimum of 6 months from date of receipt |
Sterilization Method | Filtration |
Cell Assay | Pass |
Sterility - USP modified | No Growth |
Accession Number | NP_004925 |
Recombinant Protein Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFGWVWNQFFVLE EHMGPDPQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDT TGDIHSTKSLDREQKTHYVLHAQAIDRRTNKPLEPESEFIIKVQ DINDNAPKFTDGPYIVTVPEMSDMGTSVLQVTATDADDPTYG NSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYSV VIQAKDMAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLY VPESAQVGSAVGKIKANDADTGSNADMTYSIINGDGMGIFS ISTDKETREGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSHLG PFKDATMLKIIVGDVDEPPLFSMPSYLMEVYENAKIGTVVGTVL AQDPDSTNSLVRYFINYNVEDDRFFNIDANTGTIRTTKVLDRE ETPWYNITVTASEIDNPDLLSHVTVGIRVLDVNDNPPELAREYD IIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNF TLKDNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIPSLSSS STLTIRVCACERDGRVRTCHAEAFLSS |
Directions for Use
Download the full PDF version or continue reading below:
Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.
- Thaw CDH18 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.
- Add appropriate amount of diluted material to culture surface.
- Incubate at room temperature for approximately 1 – 2 hours.
- Aspirate remaining material.
- Rinse plates carefully with dH2O– avoid scratching bottom surface of plates.
- Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.
Coating this recombinant protein at 1-10 µg / well (6 well plate) in neuronal cell specific medium can be used for 1) human neuronal cell / receptor interaction study or 2) may be used as culture matrix protein for human neuronal axon connection study in vitro.
Product Certificate of Analysis
No result for .
Product Disclaimer
This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.