Product Description

Human CDH18 gene encodes a type II classical cadherin from the cadherin superfamily of integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Human CDH18 is expressed specifically in the central nervous system and is putatively involved in synaptic adhesion, axon outgrowth and guidance.

Full-length extracellular domain of human CDH18 gene (54-608 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies.  

The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Parameter, Testing, and Method CDH18 #5090
Quantity 0.1 mg
Volume 0.2 mL
Concentration 0.5 mg/mL
Purity - SDS PAGE Electrophoresis > 90%
Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol
Form Solution
Production Type Recombinant - E. Coli
Storage Temperature -20°C
Shelf Life Minimum of 6 months from date of receipt
Sterilization Method Filtration
Cell Assay Pass
Sterility - USP modified No Growth
Accession Number NP_004925
Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFGWVWNQFFVLE
EHMGPDPQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDT
TGDIHSTKSLDREQKTHYVLHAQAIDRRTNKPLEPESEFIIKVQ
DINDNAPKFTDGPYIVTVPEMSDMGTSVLQVTATDADDPTYG
NSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYSV
VIQAKDMAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLY
VPESAQVGSAVGKIKANDADTGSNADMTYSIINGDGMGIFS
ISTDKETREGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSHLG
PFKDATMLKIIVGDVDEPPLFSMPSYLMEVYENAKIGTVVGTVL
AQDPDSTNSLVRYFINYNVEDDRFFNIDANTGTIRTTKVLDRE
ETPWYNITVTASEIDNPDLLSHVTVGIRVLDVNDNPPELAREYD
IIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNF
TLKDNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIPSLSSS
STLTIRVCACERDGRVRTCHAEAFLSS

Directions for Use

Download the full PDF version or continue reading below: 

Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.

  1. Thaw CDH18 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.
  2. Add appropriate amount of diluted material to culture surface.
  3. Incubate at room temperature for approximately 1 – 2 hours.
  4. Aspirate remaining material.
  5. Rinse plates carefully with dH2O– avoid scratching bottom surface of plates.
  6. Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.

Coating this recombinant protein at 1-10 µg / well (6 well plate) in neuronal cell specific medium can be used for 1) human neuronal cell / receptor interaction study or 2) may be used as culture matrix protein for human neuronal axon connection study in vitro.

Product Certificate of Analysis

No result for .

Safety and Documentation

Safety Data Sheet

Certificate of Origin

Product Disclaimer

This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.