Product Description

The protein encoded by human ICAM2 gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. Several transcript variants encoding the same protein have been found for this gene.

Full-length extracellular domain of human ICAM2 gene (25-223 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies.                                                                                                                        

The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.   

Parameter, Testing, and Method ICAM2 #5107
Quantity 0.1 mg
Volume 0.2 mL
Concentration 0.5 mg/mL
Purity - SDS PAGE Electrophoresis > 90%
Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol
Form Solution
Production Type Recombinant - E. Coli
Storage Temperature -20°C
Shelf Life Minimum of 6 months from date of receipt
Sterilization Method Filtration
Cell Assay Pass
Sterility - USP modified No Growth
Accession Number NP_000864
Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFELKVFEVHVRPKKLAVEPKGSLEV
NCSTTCNQPEVGGLETSLDKILLDEQAQWKHYLVSNISHDTVLQCHFTCSGKQ
ESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNET
LHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSA
PKMLEIYEPVSDSQ

Directions for Use

Download the full PDF version or continue reading below: 

Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.

  1. Thaw ICAM2 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.  Note: Use 1 ml PBS per well in a 6-well plate.
  2. Add 1 – 10 µg protein to each well and incubate at 2 to 10°C overnight.
  3. After incubation, aspirate remaining material.
  4. Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.

Coating this recombinant protein at 1-10 ug / well (6 well plate) in neuronal cell specific medium can be used for 1) human lymphocyte cell / receptor interaction study in vitro and 2)  as a culture matrix protein for anti-tumor immuno-response study in vitro.

Product References

References for Lifeink® collagen bioinks:

Lee, A. et al. 3D bioprinting of collagen to rebuild components of the human heart. Science 365, 482–487 (2019).

Maxson, Eva L., et al. "In vivo remodeling of a 3D-Bioprinted tissue engineered heart valve scaffold." Bioprinting (2019): e00059.

Filardo, G. et al.Patient-specific meniscus prototype based on 3D bioprinting of human cell-laden scaffold. Bone & Joint Research 8,101–106 (2019).

Schmitt, T. Analysis and Classification of 3-D Printed Collagen-Bioglass Matrices for Cellular Growth Utilizing Artificial Neural Networks. University Thesis (2018).

Balakhovsky, Y. M., Ostrovskiy, A. Y. & Khesuani, Y. D. Emerging Business Models Toward Commercialization of Bioprinting Technology. 3D Printing and Biofabrication1–22 (2017). doi:10.1007/978-3-319-40498-1_25-1

Fox, S. et al. A simplified fabrication technique for cellularized high-collagen dermal equivalents. Biomedical Materials14,041001 (2019).

 

Product Certificate of Analysis

No result for .

Safety and Documentation

Safety Data Sheet

Certificate of Origin

Product Disclaimer

This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.