Product Description

The protein encoded by human ICAM2 gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. Several transcript variants encoding the same protein have been found for this gene.

Full-length extracellular domain of human ICAM2 gene (25-223 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies.                                                                                                                        

The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.   

Parameter, Testing, and Method ICAM2 #5107
Quantity 0.1 mg
Volume 0.2 mL
Concentration 0.5 mg/mL
Purity - SDS PAGE Electrophoresis > 90%
Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol
Form Solution
Production Type Recombinant - E. Coli
Storage Temperature -20°C
Shelf Life Minimum of 6 months from date of receipt
Sterilization Method Filtration
Cell Assay Pass
Sterility - USP modified No Growth
Accession Number NP_000864
Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFELKVFEVHVRPKKLAVEPKGSLEV
NCSTTCNQPEVGGLETSLDKILLDEQAQWKHYLVSNISHDTVLQCHFTCSGKQ
ESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNET
LHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSA
PKMLEIYEPVSDSQ

Directions for Use

Download the full PDF version or continue reading below: 

Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.

  1. Thaw ICAM2 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.  Note: Use 1 ml PBS per well in a 6-well plate.
  2. Add 1 – 10 µg protein to each well and incubate at 2 to 10°C overnight.
  3. After incubation, aspirate remaining material.
  4. Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.

Coating this recombinant protein at 1-10 ug / well (6 well plate) in neuronal cell specific medium can be used for 1) human lymphocyte cell / receptor interaction study in vitro and 2)  as a culture matrix protein for anti-tumor immuno-response study in vitro.

Product References

References for Lifeink® collagen bioinks:

Lan, X. et al. In vitro maturation and in vivo stability of bioprinted human nasal cartilage. Journal of Tissue Engineering 13, 204173142210863 (2022).

Stocco, T. D., Moreira Silva, M. C., Corat, M. A., Gonçalves Lima, G. & Lobo, A. O. Towards bioinspired meniscus-regenerative scaffolds: Engineering A novel 3D bioprinted patient-specific construct reinforced by biomimetically aligned nanofibers. International Journal of Nanomedicine Volume 17, 1111–1124 (2022).

Lee, A. et al. 3D bioprinting of collagen to rebuild components of the human heart. Science 365, 482–487 (2019).

Maxson, Eva L., et al. "In vivo remodeling of a 3D-Bioprinted tissue engineered heart valve scaffold." Bioprinting (2019): e00059.

Filardo, G. et al.Patient-specific meniscus prototype based on 3D bioprinting of human cell-laden scaffold. Bone & Joint Research 8,101–106 (2019).

Schmitt, T. Analysis and Classification of 3-D Printed Collagen-Bioglass Matrices for Cellular Growth Utilizing Artificial Neural Networks. University Thesis (2018).

Balakhovsky, Y. M., Ostrovskiy, A. Y. & Khesuani, Y. D. Emerging Business Models Toward Commercialization of Bioprinting Technology. 3D Printing and Biofabrication1–22 (2017). doi:10.1007/978-3-319-40498-1_25-1

Fox, S. et al. A simplified fabrication technique for cellularized high-collagen dermal equivalents. Biomedical Materials14,041001 (2019).

Lin, H.-H., Chao, P.-H. G., Tai, W.-C. & Chang, P.-C. 3D-printed collagen-based waveform microfibrous scaffold for periodontal ligament reconstruction. International Journal of Molecular Sciences 22, 7725 (2021).

Engberg, A., Stelzl, C., Eriksson, O., O’Callaghan, P. & Kreuger, J. An open source extrusion bioprinter based on the E3D motion system and Tool Changer to enable fresh and multimaterial bioprinting. Scientific Reports 11, (2021).

Tashman, J., et al. "In Situ Volumetric Imaging and Analysis of FRESH 3D Bioprinted Constructs Using Optical Coherence Tomography." BioRxiv. (2021) 

 
 

 

Product Certificate of Analysis

No result for .

Safety and Documentation

Safety Data Sheet

Certificate of Origin

Product Disclaimer

This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.