-
Collagen
-
Type I - Atelocollagen
- PureCol® Solution, 3 mg/ml (bovine) #5005
- Nutragen® Solution, 6 mg/ml (bovine) #5010
- FibriCol® Solution, 10 mg/ml (bovine) #5133
- PureCol® EZ Gel, Solution, 5 mg/ml (bovine) #5074
- PureCol® Lyophilized, 15 mg (bovine) #5006
- VitroCol® Solution, 3 mg/ml (human) #5007
- VitroCol® Lyophilized, 15 mg (human) #5008
-
Type I - Telocollagen
- TeloCol®-3 Solution, 3 mg/ml (bovine) #5026
- TeloCol®-6 Solution, 6 mg/ml (bovine) #5225
- TeloCol®-10 Solution, 10 mg/ml (bovine) #5226
- RatCol® for 2D and 3D, Solution, 4 mg/ml (rat) #5153
- RatCol® High Concentration, Solution, 10 mg/ml (rat)
- RatCol® lyophilized, 100 mg (rat)
- RatCol® for Coatings, Solution, 4 mg/ml (rat) #5056
- Type I - Insoluble Collagen
- Type I - Bioinks
- Type II Collagen
- Type III Collagen
- Type IV Collagen
- Collagen Standard
-
PureCol® Collagen Coated Plates
- Custom-Coated Cultureware and Plates
- Collagen Coated T-25 Flasks #5029
- Collagen Coated 6-well Plates #5073
- Collagen Coated 12-well Plates #5439
- Collagen Coated 24-well Plates #5440
- Collagen Coated 48-well Plates #5181
- Collagen Coated 96-well Plates #5072
- Collagen Coated 384-well Plates #5380-5EA
- Collagen Coated 100 x 20 mm Dishes #5028
- MatTek Glass-Bottom Dishes
- MatTek Multi-Well Plates
- Collagen Scaffolds
- Collagen Hybridizing Peptides
-
Type I - Atelocollagen
- Tunable Stiffness
- CytoSoft® Rigidity Plates
-
Bioprinting
- Support Slurry for FRESH Bioprinting
-
Bioinks for Extrusion Bioprinting
- Lifeink® 200 Collagen Bioink (35 mg/ml) #5278
- Lifeink® 220 Collagen Bioink (70 mg/ml) #5343
- Lifeink® 240 Acidic Collagen Bioink (35 mg/ml) #5267
- Lifeink® 260 Acidic Collagen Bioink (70 mg/ml) #5358
- GelMA Bioink
- GelMA A Bioink
- GelMA C Bioink
- Pluronic F-127 40% Sterile Solution
- GelMA 20% Sterile Solution
- Alginate 5% Sterile Solution
- Photoinitiators
- Bioinks for BIONOVA X
- Bioinks for Lumen X
- DLP Printing Consumables
-
Create Your Own Bioinks
- PhotoCol® Methacrylated Collagen
- PhotoGel® Methacrylated Gelatin 95% DS
- PhotoGel® Methacrylated Gelatin 50% DS
- PhotoHA®-Stiff Methacrylated Hyaluronic Acid
- PhotoHA®-Soft Methacrylated Hyaluronic Acid
- PhotoAlginate® Methacrylated Alginate
- PhotoDextran® Methacrylated Dextran
- PEGDA (Various Molecular Weights)
- Silk Fibroin, Solution
- PhotoSericin® Methacrylated Sericin
- Bioprinters
-
3D Hydrogels
- Thermoreversible Hydrogel
- Silk Fibroin
-
Type I Collagen for 3D Hydrogels
- PureCol® Solution, 3 mg/ml (bovine) #5005
- Nutragen® Solution, 6 mg/ml (bovine) #5010
- FibriCol® Solution, 10 mg/ml (bovine) #5133
- PureCol® EZ Gel, Solution, 5 mg/ml (bovine) #5074
- VitroCol® Solution, 3 mg/ml (human) #5007
- TeloCol®-3 Solution, 3 mg/ml (bovine) #5026
- TeloCol®-6 Solution, 6 mg/ml (bovine) #5225
- TeloCol®-10 Solution, 10 mg/ml (bovine) #5226
- RatCol® for 3D gels, Solution, 4 mg/ml (rat) #5153
- HyStem® Thiolated Hyaluronic Acid
- Methacrylated Collagen
- Methacrylated Gelatin
- Methacrylated Hyaluronic Acid
- Diacrylates
- Collagen Sponges
- Methacrylated Polysaccharides
- Spheroids and Organoids
- Extracellular Matrices
- HyStem / Hyaluronic Acid
-
Adhesion Peptides / Proteins
-
Recombinant Adhesion Proteins
- CD2, 0.5 mg/ml #5086
- CDH3, 0.5 mg/ml #5124
- CDH13, 0.5 mg/ml #5125
- CD14, 0.5 mg/ml #5089
- CDH18, 0.5 mg/ml #5090
- CD40, 0.5 mg/ml #5093
- CD86, 0.5 mg/ml #5096
- CD164, 0.5 mg/ml #5100
- CD270, 0.5 mg/ml #5127
- CD274, 0.5 mg/ml #5126
- CD276, 0.5 mg/ml #5123
- E-Cadherin (CD324), 0.5 mg/ml #5085
- ICAM2, 0.5 mg/ml #5107
- Adhesion Peptides
- Collagen Hybridizing Peptides
-
Recombinant Adhesion Proteins
- Reagents
- Assays
CD164
Solution, 0.5 mg/ml (Recombinant)
Catalog #5100
CD164
Solution, 0.5 mg/ml (Recombinant)
Catalog #5100
CD164 (Sialomucins) belongs to a heterogeneous group of secreted or membrane-associated mucins that appear to play two key but opposing roles in vivo: 1) as cytoprotective or anti-adhesive agents and 2) as adhesion receptors.
Product Description
CD164 (Sialomucins) belongs to a heterogeneous group of secreted or membrane-associated mucins that appear to play two key but opposing roles in vivo: 1) as cytoprotective or anti-adhesive agents and 2) as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor. Recombinant CD164 protein may serve as coating matrix protein for studying of hematopoietic stem cell (HSC) functions in vitro.
Full-length of human CD164 extracellular domain cDNA (24 – 162 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies.
The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.
Parameter, Testing, and Method | CD164 #5100 |
Quantity | 0.05 mg |
Volume | 0.1 mL |
Concentration | 0.5 mg/mL |
Purity - SDS PAGE Electrophoresis | > 90% |
Formulation | Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol |
Form | Solution |
Production Type | Recombinant - E. Coli |
Storage Temperature | -20°C |
Shelf Life | Minimum of 6 months from date of receipt |
Sterilization Method | Filtration |
Cell Assay | Pass |
Sterility - USP modified | No Growth |
Accession Number | NP_006007 |
Recombinant Protein Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPI SNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIE CKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQ PSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD |
Directions for Use
Download the full PDF version or continue reading below:
Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.
- Thaw CD164 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly. Note: Use 1 ml PBS per well in a 6-well plate.
- Add 1 – 10 µg protein to each well and incubate at 2 to 10°C overnight.
- After incubation, aspirate remaining material.
- Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.
Coating this recombinant matrix protein at 1-10 ug / well (6 well plate) in HSC cell specific medium can be used for human HSC / receptor interaction study in vitro.
Product Certificate of Analysis
No result for .
Product Disclaimer
This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.