Product Description

Human CD86 gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms. Recombinant CD86 may service as coating matrix protein for studying of  T cell functions in vitro.

Full-length human CD86 extracellular domain cDNA (24 – 247 aa, Isoform-2) was constructed with 31 N-terminal T7/His tag and expressed in E. coli as inclusion bodies.  

The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.

Parameter, Testing, and Method CD86 #5096
Quantity 0.1 mg
Volume 0.2 mL
Concentration 0.5 mg/mL
Purity - SDS PAGE Electrophoresis > 90%
Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol
Form Solution
Production Type Recombinant - E. Coli
Storage Temperature -20°C
Shelf Life Minimum of 6 months from date of receipt
Sterilization Method Filtration
Cell Assay Pass
Sterility - USP modified No Growth
Accession Number NP_008820
Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFELPLKIQAY
FNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYL
GKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLY
QCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITE
NVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKS
QDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLS
SPFSIELEDPQPPPDHIP

Directions for Use

Download the full PDF version or continue reading below: 

Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.

  1. Thaw CD86 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.Note: Coating this recombinant protein at 1-10 µg / well (6 well plate) in T cell specific medium can be used for human study of human T cell/Receptor interactions or as a highly purified recombinant antigen, it may be used as culture matrix protein for T cells differentiation regulation study in vitro.
  2. Add appropriate amount of diluted material to culture surface.
  3. Incubate at room temperature for approximately 1 – 2 hours.
  4. Aspirate remaining material.
  5. Rinse plates carefully with dH2O– avoid scratching bottom surface of plates.
  6. Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.

Product Certificate of Analysis

No result for .

Safety and Documentation

Safety Data Sheet

Certificate of Origin

Product Disclaimer

This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.