-
Collagen
-
Type I - Atelocollagen
- PureCol® Solution, 3 mg/ml (bovine) #5005
- Nutragen® Solution, 6 mg/ml (bovine) #5010
- FibriCol® Solution, 10 mg/ml (bovine) #5133
- PureCol® EZ Gel, Solution, 5 mg/ml (bovine) #5074
- PureCol® Lyophilized, 15 mg (bovine) #5006
- VitroCol® Solution, 3 mg/ml (human) #5007
- VitroCol® Lyophilized, 15 mg (human) #5008
-
Type I - Telocollagen
- TeloCol®-3 Solution, 3 mg/ml (bovine) #5026
- TeloCol®-6 Solution, 6 mg/ml (bovine) #5225
- TeloCol®-10 Solution, 10 mg/ml (bovine) #5226
- RatCol® for 2D and 3D, Solution, 4 mg/ml (rat) #5153
- RatCol® High Concentration, Solution, 10 mg/ml (rat)
- RatCol® lyophilized, 100 mg (rat)
- RatCol® for Coatings, Solution, 4 mg/ml (rat) #5056
- Type I - Insoluble Collagen
- Type I - Bioinks
- Type II Collagen
- Type III Collagen
- Type IV Collagen
- Collagen Standard
-
PureCol® Collagen Coated Plates
- Custom-Coated Cultureware and Plates
- Collagen Coated T-25 Flasks #5029
- Collagen Coated 6-well Plates #5073
- Collagen Coated 12-well Plates #5439
- Collagen Coated 24-well Plates #5440
- Collagen Coated 48-well Plates #5181
- Collagen Coated 96-well Plates #5072
- Collagen Coated 384-well Plates #5380-5EA
- Collagen Coated 100 x 20 mm Dishes #5028
- MatTek Glass-Bottom Dishes
- MatTek Multi-Well Plates
- Collagen Scaffolds
- Collagen Hybridizing Peptides
-
Type I - Atelocollagen
- Tunable Stiffness
- CytoSoft® Rigidity Plates
-
Bioprinting
- Support Slurry for FRESH Bioprinting
-
Bioinks for Extrusion Bioprinting
- Lifeink® 200 Collagen Bioink (35 mg/ml) #5278
- Lifeink® 220 Collagen Bioink (70 mg/ml) #5343
- Lifeink® 240 Acidic Collagen Bioink (35 mg/ml) #5267
- Lifeink® 260 Acidic Collagen Bioink (70 mg/ml) #5358
- GelMA Bioink
- GelMA A Bioink
- GelMA C Bioink
- Pluronic F-127 40% Sterile Solution
- GelMA 20% Sterile Solution
- Alginate 5% Sterile Solution
- Photoinitiators
- Bioinks for BIONOVA X
- Bioinks for Lumen X
- DLP Printing Consumables
-
Create Your Own Bioinks
- PhotoCol® Methacrylated Collagen
- PhotoGel® Methacrylated Gelatin 95% DS
- PhotoGel® Methacrylated Gelatin 50% DS
- PhotoHA®-Stiff Methacrylated Hyaluronic Acid
- PhotoHA®-Soft Methacrylated Hyaluronic Acid
- PhotoAlginate® Methacrylated Alginate
- PhotoDextran® Methacrylated Dextran
- PhotoChitosan® Methacrylated Chitosan
- PEGDA (Various Molecular Weights)
- Bioprinters
-
3D Hydrogels
- Thermoreversible Hydrogel
- Silk Fibroin
-
Type I Collagen for 3D Hydrogels
- PureCol® Solution, 3 mg/ml (bovine) #5005
- Nutragen® Solution, 6 mg/ml (bovine) #5010
- FibriCol® Solution, 10 mg/ml (bovine) #5133
- PureCol® EZ Gel, Solution, 5 mg/ml (bovine) #5074
- VitroCol® Solution, 3 mg/ml (human) #5007
- TeloCol®-3 Solution, 3 mg/ml (bovine) #5026
- TeloCol®-6 Solution, 6 mg/ml (bovine) #5225
- TeloCol®-10 Solution, 10 mg/ml (bovine) #5226
- RatCol® for 3D gels, Solution, 4 mg/ml (rat) #5153
- HyStem® Thiolated Hyaluronic Acid
- Methacrylated Collagen
- Methacrylated Gelatin
- Methacrylated Hyaluronic Acid
- Diacrylates
- Collagen Sponges
- Methacrylated Polysaccharides
- Spheroids and Organoids
- Extracellular Matrices
- HyStem / Hyaluronic Acid
-
Adhesion Peptides / Proteins
-
Recombinant Adhesion Proteins
- CD2, 0.5 mg/ml #5086
- CDH3, 0.5 mg/ml #5124
- CDH13, 0.5 mg/ml #5125
- CD14, 0.5 mg/ml #5089
- CDH18, 0.5 mg/ml #5090
- CD40, 0.5 mg/ml #5093
- CD86, 0.5 mg/ml #5096
- CD164, 0.5 mg/ml #5100
- CD270, 0.5 mg/ml #5127
- CD274, 0.5 mg/ml #5126
- CD276, 0.5 mg/ml #5123
- E-Cadherin (CD324), 0.5 mg/ml #5085
- ICAM2, 0.5 mg/ml #5107
- Adhesion Peptides
- Collagen Hybridizing Peptides
-
Recombinant Adhesion Proteins
- Reagents
- Assays
E-Cadherin (CD324)
Solution, 0.5 mg/ml (Recombinant)
Catalog #5085
E-Cadherin (CD324)
Solution, 0.5 mg/ml (Recombinant)
Catalog #5085
E-Cadherin protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer.
Product Description
Human E-Cadherin (CDH1) is an 882 amino acid protein (1-23 = signal domain) that belongs to a member of the cadherin super family. The encoded protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function is thought to contribute to progression in cancer by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. Recent publication from Ding Sheng’s group indicated that coated recombinant human E-cadherin protein (extracellular domain) alone benefits human ES cell Culture.
Recombinant human E-Cadherin gene (155-710 aa Fragment) was constructed with codon optimization and expressed in non-fusion protein form in E. coli as inclusion bodies.
The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
Parameter, Testing, and Method | E-Cadherin #5085 |
Quantity | 0.1 mg |
Volume | 0.2 mL |
Concentration | 0.5 mg/mL |
Purity - SDS PAGE Electrophoresis | > 90% |
Formulation | Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol |
Form | Solution |
Production Type | Recombinant - E. Coli |
Storage Temperature | -20°C |
Shelf Life | Minimum of 6 months from date of receipt |
Sterilization Method | Filtration |
Cell Assay | Pass |
Sterility - USP modified | No Growth |
Accession Number | NP_004351.1 |
Recombinant Protein Sequence | MDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERE TGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVF KGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNT GVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYK GQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILK TAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEV SEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDRED FEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQV INIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLM DNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIP |
Directions for Use
Download the full PDF version or continue reading below:
Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.
- Thaw E-Cadherin and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly. Note: Use 1 ml PBS per well in a 6-well plate.
- Add 5 – 10 µg protein to each well and incubate at 2 to 10°C overnight.
- After incubation, aspirate remaining material.
- Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.
E-Cadherin has been used as coating matrix protein for 1) maintaining long-term ES or iPS cell culture then combine with proper ES cell culture media, 2) as a coating matrix material for 11R tag recombinant TF intracellular delivery for protein derived iPS protocol with extremely low-level non-specific interaction and 3) as a native antigen for antibody production.
Product Certificate of Analysis
No result for .
Product Disclaimer
This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.