Product Description

Human CD274 (programmed cell death 1 ligand 1) is a cell membrane protein which is involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. Recent data indicated that cancer cells that express PDL1 promote tumor progression through inhibition of PD1-expressing immune effectors. In addition, PDL1 modulates cell-mediated immunity in the infectious disease setting.

Recombinant human CD274 extracellular domain cDNA (19-238 aa, derived from BC074984) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Parameter, Testing, and Method CD274 #5126
Quantity 0.1 mg
Volume 0.2 mL
Concentration 0.5 mg/mL
Purity - SDS PAGE Electrophoresis > 90%
Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol
Form Solution
Production Type Recombinant - E. Coli
Storage Temperature -20°C
Shelf Life Minimum of 6 months from date of receipt
Sterilization Method Filtration
Cell Assay Pass
Sterility - USP modified No Growth
Accession Number NP_054862.1
Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQG^GEFFTVTVPKDLYV
VEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEE
DLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRC
MISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQA
EGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRIN
TTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Directions for Use

Download the full PDF version or continue reading below: 

Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.

  1. Thaw CD274 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.
  2. Add appropriate amount of diluted material to culture surface.
  3. Incubate at room temperature for approximately 1 – 2 hours.
  4. Aspirate remaining material.
  5. Rinse plates carefully with dH2O– avoid scratching bottom surface of plates.
  6. Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.

Coating this recombinant protein at 5-10 ug / well (6 well plate) in a specific culture medium may be used for 1) human T and B cell cells activation/differentiation study or 2) as a potential biomarker protein for infectious diseases in vitro or 3) for auto-immuno disease diagnostic development.

Product Certificate of Analysis

No result for .

Safety and Documentation

Safety Data Sheet

Certificate of Origin

Product Disclaimer

This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.